Users Online: 612
Home Print this page Email this page
Home About us Editorial board Search Browse articles Submit article Ahead of Print Instructions Subscribe Contacts Special issues Login 


 
Previous article Browse articles Next article 
ORIGINAL ARTICLE
Adv Biomed Res 2022,  11:88

Rational design of a hybrid peptide against severe acute respiratory syndrome coronavirus 2 using melittin and angiotensin-converting enzyme 2 as pharmaceutical agents


1 Department of Quality Control, Pasteur Institute of Iran, Tehran, Iran
2 Rastegar Reference Laboratory, Faculty of Veterinary Medicine, University of Tehran, Tehran, Iran
3 Department of Microbiology and Immunology, Faculty of Veterinary Medicine, University of Tehran, Tehran, Iran
4 Department of Pathobiology, School of Public Health, Tehran University of Medical Sciences, Tehran, Iran
5 Department of Parasitology, Faculty of Veterinary Medicine, University of Tehran, Tehran, Iran

Date of Submission25-Oct-2021
Date of Acceptance19-Jan-2022
Date of Web Publication29-Oct-2022

Correspondence Address:
Dr. Sedigheh Nabian
Department of Parasitology, Faculty of Veterinary Medicine, University of Tehran, Tehran
Iran
Login to access the Email id

Source of Support: None, Conflict of Interest: None


DOI: 10.4103/abr.abr_341_21

Rights and Permissions
  Abstract 


Background: Management of severe acute respiratory syndrome coronavirus 2 in humans depends on the availability of vaccines or effective drugs. Studies have shown that angiotensin-converting enzyme 2 (ACE2) is responsible for binding the viral spike glycoproteins to human cells. Melittin from the bee venom of Apis melifera is a peptide with antimicrobial activities.
Materials and Methods: In this study, important amino acid residues of ACE2 interacting with spike glycoproteins of the virus were described based on the ACE2-spike–glycoprotein interface. This has been previously analyzed by Robson in crystal structures of the receptors and ligands. Flexible linkers and 31 amino acid residues from N-terminal of ACE2 as coronavirus spike binding domains (SBDs) were added to 17 N-terminal amino acids of melittin (the hydrophobic motif) to construct a hybrid peptide or M-ACE2SBD. Then, secondary and tertiary structures of the peptide were predicted.
Results: Docking of the hybrid peptide and coronavirus SBDs was carried out as well. Previous studies showed that toxicity and hemolytic activity of the melittin hydrophobic motif decreased in comparison to native melittin due to the lack of peptide binding to the exposed anionic lipids of the human cell membranes and hence the novel peptide can be recommended as an appropriate drug for clinical uses.
Conclusion: This study has hypothesized that 17 N-terminal amino acids of the mutant melittin used in M-ACE2SBD design are potentially hydrophobic and attached coronavirus-2 through lipid envelope of the virus.

Keywords: Angiotensin-Converting Enzyme 2, Covid-19, glycoproteins


How to cite this article:
Farhoudi R, Taheri M, Soltani M, Nezhad Fard RM, Shahedin GJ, Nabian S. Rational design of a hybrid peptide against severe acute respiratory syndrome coronavirus 2 using melittin and angiotensin-converting enzyme 2 as pharmaceutical agents. Adv Biomed Res 2022;11:88

How to cite this URL:
Farhoudi R, Taheri M, Soltani M, Nezhad Fard RM, Shahedin GJ, Nabian S. Rational design of a hybrid peptide against severe acute respiratory syndrome coronavirus 2 using melittin and angiotensin-converting enzyme 2 as pharmaceutical agents. Adv Biomed Res [serial online] 2022 [cited 2023 Mar 25];11:88. Available from: https://www.advbiores.net/text.asp?2022/11/1/88/359887




  Introduction Top


Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is a novel strain of coronavirus that causes coronavirus disease 2019 (COVID-19), a respiratory infection with high mortality rates that was first detected in China in late 2019. Currently, new variants of the virus are evolving due to the virus multiple spike protein mutations. The infection has spread rapidly as a global risk. Management of COVID-19 human infection depends on the characteristics of the virus, including transmission capability, severity of resulting infection, and availability of vaccines and medicines to control severe side-effects of COVID-19. Coronaviruses are zoonotic agents, transmitting from animals to humans.[1] However, the exact source of 2019-nCoV has not been identified. Evolution of 2019-nCoV may be resulted from RNA recombination in the virus. The most frequent breakpoint combination is located in the S gene of coronavirus, encoding spike glycoproteins.[2],[3],[4] Considering the broad prevalence and large genetic diversity of the current coronavirus, the virus' close proximity and frequent recombination have been expected to emerge its novel variants. Based on the previous studies, angiotensin-converting enzyme type 2 (ACE2) that acts synergically with other receptors such as, transmembrane protease serine 2, neuropilin-1, and compact disc 147 is responsible for binding SARS-CoV-2 spike glycoproteins to epithelial cells of the respiratory and alimentary tracts. Once a human target protein and its relevant binding site on SARS-CoV-2 are clearly understood, the associated amino acids can be used for designing of potential therapeutic peptides. Therefore, modern computer-driven strategies and invention of automatable peptide synthesis platforms can be helpful. Melittin from the bee venom of Apis melifera is a peptide that shows antimicrobial, antitumor, and antiviral activities as well as other biological activities. The antimicrobial mechanism of melittin includes destruction of cell membranes. However, strong cytotoxicity of melittin limits its clinical uses.[5],[6],[7] In the current study, an artificial hybrid peptide was designed that may be used as a potential therapeutic peptide, consisting of 17 N-terminal residues of melittin with potential hydrophobic characteristics. Therefore, the peptide can attach the lipid envelope of SARS-CoV-2 with less toxicities for human cells, compared to native melittin. Another region of this hybrid peptide is associated to ACE2 domain, which is responsible for binding of SARS-CoV-2 spike glycoproteins to the respiratory and alimentary tract cells.


  Materials and Methods Top


Peptides are generally interested as great candidates for medical therapies. The major sources of data on melittin, SARS-CoV-2 virus spike glycoproteins and human ACE2, include National Center for Biotechnology Information (www.ncbi.nlm.nih.gov) and Protein Data Bank (PDB: www.rcsb.org). Briefly, 6 vw1 PDB entry was retrieved from PDB [Figure 1]. Three-dimensional (3D) crystal structures of the receptors and ligands, including ACE2 spike binding domain (SBD) and SARS-CoV-2 spike glycoprotein interface, have recently been described by Robson.[2] Associated amino acid residues in ACE2 that interact with the viral spike glycoproteins were investigated. Then, 17 N-terminal amino acids of melittin (the hydrophobic motif) and a flexible linker were added to 31 amino acid residues from the N-terminal of ACE2SBD to construct a hybrid peptide (M-ACE2SBD).[8] Using online computer pI/Mw tool from Expasy (www.expasy.org), physicochemical characteristics of the designed peptide such as molecular weight and isoelectric point were predicted. The secondary and tertiary structures of the highlighted peptide were predicted using PEP-FOLD3 server (https://bioserv.rpbs.univ-paris-diderot.fr/services/PEP-FOLD3). Docking of M-ACE2SBD and receptor-binding domain (RBD) coronavirus spike glycoproteins was carried out using online server of Jiangsu University of Technology, China (https://ncov.schanglab.org.cn) [Table 1].
Figure 1: Structure of severe acute respiratory syndrome coronavirus 2 receptor-binding domain complexed with its receptor human angiotensin-converting enzyme 2 (Protein Data Bank: 6Vw1)

Click here to view
Table 1: The minimum binding energy scores of docking

Click here to view



  Results Top


Melittin hydrophobic motif

Naturally, native melittin is consisted of 26 amino acids with a primary structure [Figure 2]a. In fact, 13 of the first 20 residues of this peptide are hydrophobic and only two are charged, whereas four of the last six residues are charged (amino acid sequences of lysin arginine lysin arginine [KRKR]) and the remaining two are polar. The amino acid residues close to melittin N-and C-terminal regions are majorly hydrophobic and hydrophilic, respectively. Polar and nonpolar residues are roughly distributed symmetrically on the two sides of each helix, leading to the formation of an amphiphilic molecular configuration. After binding to lipid membranes, melittin presents a bent rod-like conformation with two α-helices, which are connected by a non-α-helical link, as demonstrated in previous studies by experiments and molecular dynamic simulations [Figure 2]b.[9],[10],[11] The 17 N-terminal potentially hydrophobic residues of melittin include GIGAVLKVL * TTGLPALI. The “L*” wild type has been replaced by “A” followed by a flexible peptide linker of alanine-proline-glycine (underlined) as GIGAVLKVATTGLPALIAPG.
Figure 2: (a) Primary structure and (b) melittin hydrophobic motif structure. Blue, hydrophobic amino acids; orange, hydrophilicamino acids; and red, charged amino acids

Click here to view


Angiotensin-converting enzyme 2 spike binding domains

The interface of ACE2 that interacts with the virus spike glycoproteins is shown in [Figure 1].

Amino acid residues in the rectangle belong to the bent α-helix of ACE2 (green) and interact with amino acid residues in a stretched loop of SBD of SARS-CoV-2 (orange). These residues are located within a distance of 4 Å of each other and hence naturally counteract and are described as follows:

  • STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
  • G F N C Y F P L Q S Y G F Q P T.


In this alignment, ACE2 helix includes 31 amino acid residues (green) and the extended chain of coronavirus spike glycoprotein-binding domain includes 16 amino acid residues (orange) with similar lengths in 3D views.[2] Sequence from 17 N-terminal amino acids of melittin (L * wild type replaced by A) was followed by a flexible peptide linker of alanine-proline-glycine (underlined) with the remaining 31 residues belonged to A C E 2 S B D a s G I G AV L K VAT T G L P A L I A G P S T I E E Q A K T F L D K F N H E A E D L F Y Q S S L A S W N (M-ACE2SBD). Peptide folding prediction of the hybrid peptide and structural characterization of M-ACE2SBD were carried out using PEP-FOLD3 [Figure 3]. Furthermore, PI/Mw of M-ACE2SBD was calculated as PI = 4.64 and Mw = 5451 D using Expasy.
Figure 3: Peptide folding prediction of the hybrid peptide. Melittin, Accelerated Graphics Port linker and angiotensin-converting enzyme 2 domain

Click here to view


Docking results

The minimum binding energy scores of docking are shown in [Table 1]. Docking was carried out to identify minimum binding energy scores for the interactions of the highlighted sequences using the online webserver of Jiangsu University of Technology, China. The minimum binding energy for the interactions between M-ACE2SBD and coronavirus spike glycoprotein RBD was calculated as-276 kcal/mol. In general, M-ACE2SBD has been shown to include good binding scores for the coronavirus SBD and may serve as a therapeutic candidate for SARS-CoV-2.


  Discussion Top


In this study, a potential α-helix upper domain of ACE2 was used as a virus-binding sequence for the construction of a hybrid peptide against SARS-CoV-2. Designing of hybrid peptides with SARS-CoV-2-binding domain of ACE2 and virus envelope disrupting motif of melittin as a therapeutic vehicle against the virus needs further attentions. Bioinformatics is a powerful tool for the study of protein sequences. In the present study, an artificial hybrid peptide of M-ACE2SBD with 51 amino acids was designed, including GIGAVAKVLTTGLPALIAGPSTIEEQ AKTFLDKFNHEAEDLFYQSSLASWN. Sequence of 17 N-terminal amino acids belonged to melittin hydrophobic motif included GIGAVL * KVLTTGLPALI (L * wild type replaced by A to decrease hemolytic activity). According to Robson, sequence of ACE2SBD included STIEEQAKTFLDKFNHEAEDLFYQSSLASWN.[2] This peptide was ligated using a flexible peptide linker of alanine-proline-glycine.[5] Similar lengths were identified in the alignment of 31 amino acid residues from ACE2 helix with 16 amino acid residues from the stretched loop of the virus spike glycoproteins [Figure 1]. Each amino acid in α-helix of ACE2SBD increased the overall length by approximately 1.5Å. However, each amino acid in β-strand or stretched chain of the virus spike glycoproteins that interacted with ACE2SBD increased the molecule length by approximately 3.5Å. In general, associated geometry usually sets the two sequences as one-to-one spatial correspondence and facilitates their interactions close at the interface, causing overall intimate contacts.[2] Conserved sequences or domains, which are recognizable in various coronavirus genomes, seem to include important functions. These sites may less likely acquire resistance by mutations. Conformational analysis of the spike glycoprotein binding to ACE2 suggests conservation of the glycoprotein and its appropriateness for vaccine design and therapeutic drug discovery. However, a limited number of accessible conserved sites exist in the spike glycoproteins. If amino acid residues of the stretched loop of the virus spike glycoproteins produce scape mutations, the designed peptides may not be helpful and drug resistance may appear. No significant information is available on the involvement of glycosylation in major interior interaction face of the complex and intimate interactions occurring between the relative amino acid residues.[2]

Modification of antimicrobial peptide structures fascinates researchers to design hybrid peptides that act further specifically and are safer for clinical uses. Studies have revealed that the leucine zipper motif of melittin plays critical roles in the substance hemolytic activity.[12] In the present study, 17 N-terminal residues of melittin were selected for the construction of M-ACE2SBD, lacking leucine 6 and tryptophan 19 of melittin. Blondelle showed that tryptophan 19 of melittin affected the hemolytic activity of this peptide.[13] Thus, hemolytic activity of the designed peptide majorly decreased. Based on the previous studies, four basic amino acids (KRKR) at C-terminal of melittin are responsible for the peptide binding to exposed anionic lipids of the cell membranes.[9] Therefore, lack of the four basic amino acids decreases melittin cytotoxicity. Studies have demonstrated that SARS-CoV-2 can effectively be inactivated by lipid solvents, including ether (75%) and ethanol.[14] As previously described, only a small fraction of melittin is in a pore-competent transmembrane state at the same time and 17 N-terminal residues of melittin are potentially hydrophobic, which attach SARS-CoV-2 via lipid envelope of the virus.

Naturally, melittin folds into an amphipathic α-helix with a nonpolar surface that drives partitioning into bilayer lipid membranes. The cationic C-terminal segment of melittin drives its binding to anionic lipids; however, M-ACE2SBD lacks this segment. Melittinα-helix is separated into two structurally independent segments by a critical helix-breaking proline residue at position 14, resulting in a dynamic disordered pore state. In addition to these basic architectural principles, melittin is mostly monomeric in membranes, including its helical axis predominantly oriented parallel to the membrane surface.[15] Based on the docking results, the minimum binding energy between M-ACE2SBD and the virus spike glycoproteins was −276 kcal/mol. Therefore, M-ACE2SBD may help researchers treat COVID-19. However, these data need further in vitro and in vivo assessments to verify M-ACE2SBD as a drug against COVID-19. Recent studies have shown that patients infected with SARS-CoV-2 suffer from pneumonia, mostly with severely low oxygen saturation levels of only 50%. Primarily, COVID-19 pneumonia causes oxygen deprivation that is difficult to detect because patients may not experience significant breathing difficulties, hence causing a condition termed silent hypoxia. Under this condition, blood oxygen level decreases, leading to hypoxia in the patients.[16] Accumulated data from several studies have shown that recombinant adenoviruses carrying MEL genes with hypoxia response element (HRE)-AFP promoters or survivin promoters (specifically active in tumor cells) are used to selectively express melittin in tumor cells and induce cytotoxicity.[17],[18],[19],[20] Further studies are necessary to show if recombinant adenoviruses carrying M-ACE2SBD genes with HRE-AFP promoter scan be used for the treatment of patients infected with SARS-CoV-2.


  Conclusion Top


In the current study, docking of a designed peptide (M-ACE2SBD) and coronavirus spike glycoprotein-binding domain has received good binding scores. This study has hypothesized that 17 N-terminal amino acids of the mutant melittin used in M-ACE2SBD design are potentially hydrophobic and attach coronavirus-2 through lipid envelope of the virus. Toxicity and hemolytic activity of the melittin hydrophobic motif decrease in comparison to the native melittin due to lack of peptide binding to the exposed anionic lipids of human cell membranes and hence can be recommended as an appropriate drug for clinical uses. However, this fusion peptide may include toxicities on normal cells and safety should be addressed in complementary studies. Furthermore, ACE2SBD has resulted in specificity of the designed M-ACE2SBD for SARS-CoV-2, which attaches to the virus and selectively degrades it.

Financial support and sponsorship

Nil.

Conflicts of interest

There are no conflicts of interest.



 
  References Top

1.
Ye ZW, Yuan S, Yuen KS, Fung SY, Chan CP, Jin DY. Zoonotic origins of human coronaviruses. Int J Biol Sci 2020;16:1686-97.  Back to cited text no. 1
    
2.
Robson B. COVID-19 Coronavirus spike protein analysis for synthetic vaccines, a peptidomimetic antagonist, and therapeutic drugs, and analysis of a proposed Achilles' heel conserved region to minimize probability of escape mutations and drug resistance. Comput Biol Med 2020;121:103749.  Back to cited text no. 2
    
3.
Huang Y, Yang C, Xu XF, Xu W, Liu SW. Structural and functional properties of SARS-CoV-2 spike protein: Potential antivirus drug development for COVID-19. Acta Pharmacol Sin 2020;41:1141-9.  Back to cited text no. 3
    
4.
Bosch BJ, van der Zee R, de Haan CA, Rottier PJ. The coronavirus spike protein is a class I virus fusion protein: Structural and functional characterization of the fusion core complex. J Virol 2003;77:8801-11.  Back to cited text no. 4
    
5.
Wimley WC. The antimicrobial mechanism of melittin include destruction of cell membrane. Biophysical J 2018;114:251-3.  Back to cited text no. 5
    
6.
El-Seedi H, Abd El-Wahed A, Yosri N, Musharraf SG, Chen L, Moustafa M, et al. Antimicrobial properties of Apis mellifera's bee venom. Toxins (Basel) 2020;12:451.  Back to cited text no. 6
    
7.
Zolfagharian H, Mohajeri M, Babaie M. Bee venom (Apis Mellifera) an effective potential alternative to gentamicin for specific bacteria strains: Bee venom an effective potential for bacteria. J Pharmacopuncture 2016;19:225-30.  Back to cited text no. 7
    
8.
Jiang X, Qian K, Liu G, Sun L, Zhou G, Li J, et al. Design and activity study of a melittin-thanatin hybrid peptide. AMB Express 2019;9:14.  Back to cited text no. 8
    
9.
Saugar JM, Rodriguez-Hernandez MJ, de la Torre BG, Pachon-Ibanez ME, Fernández-Reyes M, Andreu D, et al. Activity of cecropin A-melittin hybrid peptides against colistin-resistant clinical strains of Acinetobacter baumannii: Molecular basis for the differential mechanisms of action. Antimicrob Agents Chemother 2006;50:1251-6.  Back to cited text no. 9
    
10.
Saugar JM, Alarcon T, Lopez-Hernandez S, Lopez-Brea M, Andreu D, Rivas L. Activities of polymyxin B and cecropin A-, melittin peptide CA (1-8) M (1-18) against a multiresistant strain of Acinetobacter baumannii. Antimicrob Agents Chemother 2002;46:875-8.  Back to cited text no. 10
    
11.
Hong J, Lu X, Deng Z, Xiao S, Yuan B, Yang K. How melittin inserts into cell membrane: Conformational changes, inter-peptide cooperation, and disturbance on the membrane. Molecules 2019;24:1775.  Back to cited text no. 11
    
12.
Asthana N, Yadav SP, Ghosh JK. Dissection of antibacterial and toxic activity of melittin: A leucine zipper motif plays a crucial role in determining its hemolytic activity but not antibacterial activity. J Biol Chem 2004;279:55042-50.  Back to cited text no. 12
    
13.
Blondelle SE, Simpkins LR, Perez-Paya E, Houghten RA. Influence of tryptophan residues on melittin's hemolytic activity. Biochim Biophys Acta 1993;1202:331-6.  Back to cited text no. 13
    
14.
Rady I, Siddiqui I.A, Rady M, Mukhtar H. Melittin, a major peptide component of bee venom, and its conjugates in cancer therapy. Cancer letter 2017; 402:16-31.  Back to cited text no. 14
    
15.
Terwilligert TC, Eisenberggn D. The structure of melittin. J Biol Chem 1983;257:6016-22.  Back to cited text no. 15
    
16.
Teo J. Early detection of silent hypoxia in COVID-19 pneumonia using smartphone pulse oximetry. J Med Syst 2020;44:134.  Back to cited text no. 16
    
17.
Qian CY, Wang KL, Fang FF, Gu W, Huang F, Wang FZ, et al. Triple-controlled oncolytic adenovirus expressing melittin to exert inhibitory efficacy on hepatocellular carcinoma. Int J Clin Exp Pathol 2015;8:10403-11.  Back to cited text no. 17
    
18.
Ling CQ, Li B, Zhang C, Zhu DZ, Huang XQ, Gu W, et al. Inhibitory effect of recombinant adenovirus carrying melittin gene on hepatocellular carcinoma. Ann Oncol 2005;16:109-15.  Back to cited text no. 18
    
19.
Qu L, Jiang M, Li Z, Pu F, Gong L, Sun L, et al. Inhibitory effect of biosynthetic nanoscale peptide Melittin on hepatocellular carcinoma, driven by survivin promoter. J Biomed Nanotechnol 2014;10:695-706.  Back to cited text no. 19
    
20.
Abudoureyimu M, Lai Y, Tian C, Wang T, Wang R, Chu X. Oncolytic adenovirus – A nova for gene-targeted oncolytic viral therapy in HCC. Front Oncol 2019;9:1182.  Back to cited text no. 20
    


    Figures

  [Figure 1], [Figure 2], [Figure 3]
 
 
    Tables

  [Table 1]



 

Top
Previous article  Next article
 
  Search
 
Similar in PUBMED
   Search Pubmed for
   Search in Google Scholar for
 Related articles
Access Statistics
Email Alert *
Add to My List *
* Registration required (free)

 
  In this article
Abstract
Introduction
Materials and Me...
Results
Discussion
Conclusion
References
Article Figures
Article Tables

 Article Access Statistics
    Viewed732    
    Printed24    
    Emailed0    
    PDF Downloaded138    
    Comments [Add]    

Recommend this journal